GOLGA7 Blocking Peptide (33R-1074)

A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGA7 antibody, catalog no. 70R-2903

Synonyms GOLGA7 control peptide, GOLGA7 antibody Blocking Peptide, Anti-GOLGA7 Blocking Peptide, Golgi Autoantigen Golgin Subfamily A 7 Blocking Peptide, GCP16 Blocking Peptide, GOLGA3AP1 Blocking Peptide, HSPC041 Blocking Peptide, MGC21096 Blocking Peptide, MGC4876 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors