GOLGA7 Blocking Peptide (33R-1074)
A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGA7 antibody, catalog no. 70R-2903
Overview
Overview
| Synonyms | GOLGA7 control peptide, GOLGA7 antibody Blocking Peptide, Anti-GOLGA7 Blocking Peptide, Golgi Autoantigen Golgin Subfamily A 7 Blocking Peptide, GCP16 Blocking Peptide, GOLGA3AP1 Blocking Peptide, HSPC041 Blocking Peptide, MGC21096 Blocking Peptide, MGC4876 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL |
|---|---|
| Molecular Weight | 16 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product