GORASP1 Blocking Peptide (33R-7444)
A synthetic peptide for use as a blocking control in assays to test for specificity of GORASP1 antibody, catalog no. 70R-3717
Overview
Overview
| Synonyms | GORASP1 control peptide, GORASP1 antibody Blocking Peptide, Anti-GORASP1 Blocking Peptide, Golgi Reassembly Stacking Protein 1 65Kda Blocking Peptide, FLJ23443 Blocking Peptide, GOLPH5 Blocking Peptide, GRASP65 Blocking Peptide, MGC118894 Blocking Peptide, MGC118897 Blocking Peptide, P65 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product