GORASP1 Blocking Peptide (33R-7444)

A synthetic peptide for use as a blocking control in assays to test for specificity of GORASP1 antibody, catalog no. 70R-3717

Synonyms GORASP1 control peptide, GORASP1 antibody Blocking Peptide, Anti-GORASP1 Blocking Peptide, Golgi Reassembly Stacking Protein 1 65Kda Blocking Peptide, FLJ23443 Blocking Peptide, GOLPH5 Blocking Peptide, GRASP65 Blocking Peptide, MGC118894 Blocking Peptide, MGC118897 Blocking Peptide, P65 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors