GP9 Blocking Peptide (33R-10371)

A synthetic peptide for use as a blocking control in assays to test for specificity of GP9 antibody, catalog no. 70R-10332

Synonyms GP9 control peptide, GP9 antibody Blocking Peptide, Anti-GP9 Blocking Peptide, glycoprotein IX, platelet Blocking Peptide, CD42a Blocking Peptide, GPIX Blocking Peptide, GP9, GP-9, GP 9, GP-9 Blocking Peptide, GP 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQ
Molecular Weight 19 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors