GPC3 antibody (70R-1567)

Rabbit polyclonal GPC3 antibody raised against the middle region of GPC3

Synonyms Polyclonal GPC3 antibody, Anti-GPC3 antibody, Glypican 3 antibody
Specificity GPC3 antibody was raised against the middle region of GPC3
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Assay Information GPC3 Blocking Peptide, catalog no. 33R-3080, is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody

Images

Western Blot analysis using GPC3 antibody (70R-1567)

GPC3 antibody (70R-1567) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GPC3 antibody (70R-1567) | GPC3 antibody (70R-1567) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €262.58
Size: 100 ug
OR
Shipping
View Our Distributors