GPC3 antibody (70R-1567)
Rabbit polyclonal GPC3 antibody raised against the middle region of GPC3
Overview
Overview
| Synonyms | Polyclonal GPC3 antibody, Anti-GPC3 antibody, Glypican 3 antibody |
|---|---|
| Specificity | GPC3 antibody was raised against the middle region of GPC3 |
| Cross Reactivity | Human, Mouse, Rat, Dog |
| Applications | IHC, WB |
| Immunogen | GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
| Assay Information | GPC3 Blocking Peptide, catalog no. 33R-3080, is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody |
Images
Western Blot analysis using GPC3 antibody (70R-1567)
GPC3 antibody (70R-1567) used at 2.5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Total IgG Protein A purified |
| Molecular Weight | 64 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 2.5 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product