GPD1 antibody (70R-3143)

Rabbit polyclonal GPD1 antibody

Synonyms Polyclonal GPD1 antibody, Anti-GPD1 antibody, FLJ26652 antibody, Glycerol-3-Phosphate Dehydrogenase 1 antibody
Cross Reactivity Human
Applications WB
Immunogen GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
Assay Information GPD1 Blocking Peptide, catalog no. 33R-9068, is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody


Western Blot analysis using GPD1 antibody (70R-3143)

GPD1 antibody (70R-3143) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GPD1 antibody (70R-3143) | GPD1 antibody (70R-3143) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors