GPD1L antibody (70R-3132)

Rabbit polyclonal GPD1L antibody raised against the middle region of GPD1L

Synonyms Polyclonal GPD1L antibody, Anti-GPD1L antibody, Glycerol-3-Phosphate Dehydrogenase 1-Like antibody, KIAA0089 antibody
Specificity GPD1L antibody was raised against the middle region of GPD1L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GPD1L antibody was raised using the middle region of GPD1L corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV
Assay Information GPD1L Blocking Peptide, catalog no. 33R-2538, is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody


Western Blot analysis using GPD1L antibody (70R-3132)

GPD1L antibody (70R-3132) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPD1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GPD1L antibody (70R-3132) | GPD1L antibody (70R-3132) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors