Granzyme H antibody (70R-1596)

Rabbit polyclonal Granzyme H antibody

Synonyms Polyclonal Granzyme H antibody, Anti-Granzyme H antibody, CTSGL2 antibody, CCP-X antibody, CGL-2 antibody, GZMH antibody, Protein H-Ccpx antibody, Cathepsin G-Like 2, CSP-C antibody, CTLA1 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
Assay Information Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody

Images

Immunohistochemical staining using Granzyme H antibody (70R-1596)

Granzyme H antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GZMH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Granzyme H antibody (70R-1596) | Granzyme H antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using Granzyme H antibody (70R-1596) | Granzyme H antibody (70R-1596) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors