GRIP1 Blocking Peptide (33R-8113)
A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 70R-7931
Overview
Overview
| Synonyms | GRIP1 control peptide, GRIP1 antibody Blocking Peptide, Anti-GRIP1 Blocking Peptide, glutamate receptor interacting protein 1 Blocking Peptide, GRIP1, GRIP-1, GRIP 1, GRIP-1 Blocking Peptide, GRIP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTP |
|---|---|
| Molecular Weight | 92 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GRIP1 may play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product