GRIP1 Blocking Peptide (33R-8113)

A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 70R-7931

Synonyms GRIP1 control peptide, GRIP1 antibody Blocking Peptide, Anti-GRIP1 Blocking Peptide, glutamate receptor interacting protein 1 Blocking Peptide, GRIP1, GRIP-1, GRIP 1, GRIP-1 Blocking Peptide, GRIP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTP
Molecular Weight 92 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRIP1 may play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors