GRIPAP1 antibody (70R-3714)

Rabbit polyclonal GRIPAP1 antibody raised against the N terminal of GRIPAP1

Synonyms Polyclonal GRIPAP1 antibody, Anti-GRIPAP1 antibody, DKFZp434P0630 antibody, Grip1 Associated Protein 1 antibody, KIAA1167 antibody, MGC126595 antibody, MGC126593 antibody, GRASP-1 antibody
Specificity GRIPAP1 antibody was raised against the N terminal of GRIPAP1
Cross Reactivity Human
Applications WB
Immunogen GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV
Assay Information GRIPAP1 Blocking Peptide, catalog no. 33R-2618, is also available for use as a blocking control in assays to test for specificity of this GRIPAP1 antibody


Western Blot analysis using GRIPAP1 antibody (70R-3714)

GRIPAP1 antibody (70R-3714) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIPAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms, however, the full-length nature and biological validity of all of these variants have not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GRIPAP1 antibody (70R-3714) | GRIPAP1 antibody (70R-3714) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors