GRK1 Blocking Peptide (33R-6739)
A synthetic peptide for use as a blocking control in assays to test for specificity of GRK1 antibody, catalog no. 70R-9885
Overview
Overview
| Synonyms | GRK1 control peptide, GRK1 antibody Blocking Peptide, Anti-GRK1 Blocking Peptide, G protein-coupled receptor kinase 1 Blocking Peptide, GPRK1 Blocking Peptide, RHOK Blocking Peptide, RK Blocking Peptide, GRK1, GRK-1, GRK 1, GRK-1 Blocking Peptide, GRK 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR |
|---|---|
| Molecular Weight | 63 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product