GRK1 Blocking Peptide (33R-6739)

A synthetic peptide for use as a blocking control in assays to test for specificity of GRK1 antibody, catalog no. 70R-9885

Synonyms GRK1 control peptide, GRK1 antibody Blocking Peptide, Anti-GRK1 Blocking Peptide, G protein-coupled receptor kinase 1 Blocking Peptide, GPRK1 Blocking Peptide, RHOK Blocking Peptide, RK Blocking Peptide, GRK1, GRK-1, GRK 1, GRK-1 Blocking Peptide, GRK 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR
Molecular Weight 63 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors