GRSF1 antibody (70R-1376)

Rabbit polyclonal GRSF1 antibody raised against the N terminal of GRSF1

Synonyms Polyclonal GRSF1 antibody, Anti-GRSF1 antibody, G-Rich Rna Sequence Binding Factor 1 antibody
Specificity GRSF1 antibody was raised against the N terminal of GRSF1
Cross Reactivity Human
Applications WB
Immunogen GRSF1 antibody was raised using the N terminal of GRSF1 corresponding to a region with amino acids SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL
Assay Information GRSF1 Blocking Peptide, catalog no. 33R-8338, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody


Western Blot analysis using GRSF1 antibody (70R-1376)

GRSF1 antibody (70R-1376) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GRSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GRSF1 antibody (70R-1376) | GRSF1 antibody (70R-1376) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors