GSDML antibody (70R-2356)

Rabbit polyclonal GSDML antibody raised against the N terminal of GSDML

Synonyms Polyclonal GSDML antibody, Anti-GSDML antibody, PP4052 antibody, Gasdermin-Like antibody, PRO2521 antibody
Specificity GSDML antibody was raised against the N terminal of GSDML
Cross Reactivity Human
Applications WB
Immunogen GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL
Assay Information GSDML Blocking Peptide, catalog no. 33R-3791, is also available for use as a blocking control in assays to test for specificity of this GSDML antibody


Western Blot analysis using GSDML antibody (70R-2356)

GSDML antibody (70R-2356) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSDML antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway. It may also play a role in achieving and maintaining the final differentiation state of epithelial cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GSDML antibody (70R-2356) | GSDML antibody (70R-2356) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors