GSTA4 antibody (70R-2577)

Rabbit polyclonal GSTA4 antibody raised against the C terminal of GSTA4

Synonyms Polyclonal GSTA4 antibody, Anti-GSTA4 antibody, GSTA-4, DKFZp686D21185 antibody, GSTA-4 antibody, GTA4 antibody, GSTA 4, GSTA 4 antibody, Glutathione S-Transferase A4 antibody, GSTA4-4 antibody, GSTA4
Specificity GSTA4 antibody was raised against the C terminal of GSTA4
Cross Reactivity Human
Applications WB
Immunogen GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Assay Information GSTA4 Blocking Peptide, catalog no. 33R-5405, is also available for use as a blocking control in assays to test for specificity of this GSTA4 antibody


Western Blot analysis using GSTA4 antibody (70R-2577)

GSTA4 antibody (70R-2577) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GSTA4 antibody (70R-2577) | GSTA4 antibody (70R-2577) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors