GSTK1 antibody (70R-2610)

Rabbit polyclonal GSTK1 antibody raised against the N terminal of GSTK1

Synonyms Polyclonal GSTK1 antibody, Anti-GSTK1 antibody, GSTK 1 antibody, GSTK-1, GSTK1, GST13 antibody, GSTK 1, Glutathione S-Transferase Kappa 1 antibody, GSTK-1 antibody
Specificity GSTK1 antibody was raised against the N terminal of GSTK1
Cross Reactivity Human
Applications WB
Immunogen GSTK1 antibody was raised using the N terminal of GSTK1 corresponding to a region with amino acids NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK
Assay Information GSTK1 Blocking Peptide, catalog no. 33R-6769, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody

Images

Western Blot analysis using GSTK1 antibody (70R-2610)

GSTK1 antibody (70R-2610) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSTK1 antibody (70R-2610) | GSTK1 antibody (70R-2610) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors