GSTM3 antibody (70R-5244)

Rabbit polyclonal GSTM3 antibody

Synonyms Polyclonal GSTM3 antibody, Anti-GSTM3 antibody, GSTM3-3 antibody, MGC3310 antibody, GSTM3, GSTB antibody, GSTM-3 antibody, GSTM 3, MGC3704 antibody, GSTM-3, GSTM 3 antibody, GST5 antibody, GTM3 antibody, Glutathione S-Transferase M3 antibody
Cross Reactivity Human
Applications WB
Immunogen GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF
Assay Information GSTM3 Blocking Peptide, catalog no. 33R-2367, is also available for use as a blocking control in assays to test for specificity of this GSTM3 antibody


Western Blot analysis using GSTM3 antibody (70R-5244)

GSTM3 antibody (70R-5244) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GSTM3 antibody (70R-5244) | GSTM3 antibody (70R-5244) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors