GSTZ1 antibody (70R-1182)

Rabbit polyclonal GSTZ1 antibody

Synonyms Polyclonal GSTZ1 antibody, Anti-GSTZ1 antibody, GSTZ1, GSTZ-1, GSTZ 1, MAI antibody, GSTZ 1 antibody, Glutathione Transferase Zeta 1 antibody, GSTZ1-1 antibody, MGC2029 antibody, GSTZ-1 antibody, Maleylacetoacetate Isomerase antibody, MAAI antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
Assay Information GSTZ1 Blocking Peptide, catalog no. 33R-6317, is also available for use as a blocking control in assays to test for specificity of this GSTZ1 antibody

Images

Western Blot analysis using GSTZ1 antibody (70R-1182)

GSTZ1 antibody (70R-1182) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GSTZ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSTZ1 antibody (70R-1182) | GSTZ1 antibody (70R-1182) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors