GTDC1 antibody (70R-2189)

Rabbit polyclonal GTDC1 antibody raised against the N terminal of GTDC1

Synonyms Polyclonal GTDC1 antibody, Anti-GTDC1 antibody, GTDC 1, GTDC 1 antibody, Glycosyltransferase-Like Domain Containing 1 antibody, GTDC-1, GTDC1, mat-Xa antibody, GTDC-1 antibody
Specificity GTDC1 antibody was raised against the N terminal of GTDC1
Cross Reactivity Human,Mouse
Applications WB
Immunogen GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK
Assay Information GTDC1 Blocking Peptide, catalog no. 33R-1780, is also available for use as a blocking control in assays to test for specificity of this GTDC1 antibody


Western Blot analysis using GTDC1 antibody (70R-2189)

GTDC1 antibody (70R-2189) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GTDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GTDC1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GTDC1 antibody (70R-2189) | GTDC1 antibody (70R-2189) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors