GTPBP10 antibody (70R-2076)

Rabbit polyclonal GTPBP10 antibody

Synonyms Polyclonal GTPBP10 antibody, Anti-GTPBP10 antibody, GTPBP-10, DKFZP686A10121 antibody, MGC104191 antibody, Gtp-Binding Protein 10 antibody, GTPBP-10 antibody, GTPBP 10, ObgH2 antibody, DKFZp686A10121 antibody, FLJ38242 antibody, UG0751c10 antibody, GTPBP 10 antibody, GTPBP10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL
Assay Information GTPBP10 Blocking Peptide, catalog no. 33R-4002, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody


Immunohistochemical staining using GTPBP10 antibody (70R-2076)

GTPBP10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GTPBP10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GTPBP10 antibody (70R-2076) | GTPBP10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GTPBP10 antibody (70R-2076) | GTPBP10 antibody (70R-2076) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors