GTPBP10 antibody (70R-2076)

Rabbit polyclonal GTPBP10 antibody

Synonyms Polyclonal GTPBP10 antibody, Anti-GTPBP10 antibody, GTPBP-10, DKFZP686A10121 antibody, MGC104191 antibody, Gtp-Binding Protein 10 antibody, GTPBP-10 antibody, GTPBP 10, ObgH2 antibody, DKFZp686A10121 antibody, FLJ38242 antibody, UG0751c10 antibody, GTPBP 10 antibody, GTPBP10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL
Assay Information GTPBP10 Blocking Peptide, catalog no. 33R-4002, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody

Images

Western Blot analysis using GTPBP10 antibody (70R-2076)

GTPBP10 antibody (70R-2076) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GTPBP10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GTPBP10 antibody (70R-2076) | GTPBP10 antibody (70R-2076) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors