GTSE1 antibody (70R-5496)

Rabbit polyclonal GTSE1 antibody raised against the N terminal of GTSE1

Synonyms Polyclonal GTSE1 antibody, Anti-GTSE1 antibody, GTSE-1 antibody, GTSE 1 antibody, G-2 And S-Phase Expressed 1 antibody, GTSE 1, GTSE-1, GTSE1, B99 antibody
Specificity GTSE1 antibody was raised against the N terminal of GTSE1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA
Assay Information GTSE1 Blocking Peptide, catalog no. 33R-6810, is also available for use as a blocking control in assays to test for specificity of this GTSE1 antibody

Images

Western Blot analysis using GTSE1 antibody (70R-5496)

GTSE1 antibody (70R-5496) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GTSE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GTSE1 antibody (70R-5496) | GTSE1 antibody (70R-5496) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors