GTSE1 Blocking Peptide (33R-6810)

A synthetic peptide for use as a blocking control in assays to test for specificity of GTSE1 antibody, catalog no. 70R-5496

Synonyms GTSE1 control peptide, GTSE1 antibody Blocking Peptide, Anti-GTSE1 Blocking Peptide, G-2 And S-Phase Expressed 1 Blocking Peptide, B99 Blocking Peptide, GTSE1, GTSE-1, GTSE 1, GTSE-1 Blocking Peptide, GTSE 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA
Molecular Weight 76 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors