GUCA1A antibody (70R-2671)

Rabbit polyclonal GUCA1A antibody

Synonyms Polyclonal GUCA1A antibody, Anti-GUCA1A antibody, GUCA antibody, GUCA1 antibody, Guanylate Cyclase Activator 1A antibody, COD3 antibody, GCAP antibody, GCAP1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GUCA1A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK
Assay Information GUCA1A Blocking Peptide, catalog no. 33R-5562, is also available for use as a blocking control in assays to test for specificity of this GUCA1A antibody

Images

Western Blot analysis using GUCA1A antibody (70R-2671)

GUCA1A antibody (70R-2671) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GUCA1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GUCA1A antibody (70R-2671) | GUCA1A antibody (70R-2671) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors