GUK1 Blocking Peptide (33R-3939)
A synthetic peptide for use as a blocking control in assays to test for specificity of GUK1 antibody, catalog no. 70R-2009
Overview
Overview
| Synonyms | GUK1 control peptide, GUK1 antibody Blocking Peptide, Anti-GUK1 Blocking Peptide, Guanylate Kinase 1 Blocking Peptide, GMK Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GUK1 is essential for recycling GMP and indirectly, cGMP. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product