H2AFX antibody (70R-2028)

Rabbit polyclonal H2AFX antibody raised against the N terminal of H2AFX

Synonyms Polyclonal H2AFX antibody, Anti-H2AFX antibody, HAF 2 antibody, HAF-2 antibody, H2A/X antibody, H2AX antibody, H2A Histone X antibody, HAF 2, HAF-2, H2AF, H2A.X antibody
Specificity H2AFX antibody was raised against the N terminal of H2AFX
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen H2AFX antibody was raised using the N terminal of H2AFX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY
Assay Information H2AFX Blocking Peptide, catalog no. 33R-8485, is also available for use as a blocking control in assays to test for specificity of this H2AFX antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of H2AFX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors