HADH antibody (70R-2486)

Rabbit polyclonal HADH antibody raised against the C terminal of HADH

Synonyms Polyclonal HADH antibody, Anti-HADH antibody, HADH1 antibody, M/SCHAD antibody, MGC8392 antibody, SCHAD antibody, HADHSC antibody, HHF4 antibody, HAD antibody, Hydroxyacyl-Coenzyme A Dehydrogenase antibody
Specificity HADH antibody was raised against the C terminal of HADH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
Assay Information HADH Blocking Peptide, catalog no. 33R-10203, is also available for use as a blocking control in assays to test for specificity of this HADH antibody


Western Blot analysis using HADH antibody (70R-2486)

HADH antibody (70R-2486) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HADH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HADH antibody (70R-2486) | HADH antibody (70R-2486) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors