HAL antibody (70R-2243)

Rabbit polyclonal HAL antibody raised against the N terminal of HAL

Synonyms Polyclonal HAL antibody, Anti-HAL antibody, HIS antibody, Histidine Ammonia-Lyase antibody, HSTD antibody, histidase antibody
Specificity HAL antibody was raised against the N terminal of HAL
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET
Assay Information HAL Blocking Peptide, catalog no. 33R-4075, is also available for use as a blocking control in assays to test for specificity of this HAL antibody


Immunohistochemical staining using HAL antibody (70R-2243)

HAL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HAL antibody (70R-2243) | HAL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using HAL antibody (70R-2243) | HAL antibody (70R-2243) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors