Hand2 Blocking Peptide (33R-2133)
A synthetic peptide for use as a blocking control in assays to test for specificity of Hand2 antibody, catalog no. 70R-7837
Overview
Overview
| Synonyms | Hand2 control peptide, Hand2 antibody Blocking Peptide, Anti-Hand2 Blocking Peptide, heart and neural crest derivatives expressed transcript 2 Blocking Peptide, AI225906 Blocking Peptide, AI661148 Blocking Peptide, Ehand2 Blocking Peptide, Hed Blocking Peptide, Th2 Blocking Peptide, Thing2 Blocking Peptide, bHLHa26 Blocking Peptide, dHAND Blocking Peptide, Hand2, Hand-2, Hand 2, Hand-2 Blocking Peptide, Hand 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product