Hand2 Blocking Peptide (33R-2133)

A synthetic peptide for use as a blocking control in assays to test for specificity of Hand2 antibody, catalog no. 70R-7837

Synonyms Hand2 control peptide, Hand2 antibody Blocking Peptide, Anti-Hand2 Blocking Peptide, heart and neural crest derivatives expressed transcript 2 Blocking Peptide, AI225906 Blocking Peptide, AI661148 Blocking Peptide, Ehand2 Blocking Peptide, Hed Blocking Peptide, Th2 Blocking Peptide, Thing2 Blocking Peptide, bHLHa26 Blocking Peptide, dHAND Blocking Peptide, Hand2, Hand-2, Hand 2, Hand-2 Blocking Peptide, Hand 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors