HAVCR2 Blocking Peptide (33R-6002)
A synthetic peptide for use as a blocking control in assays to test for specificity of HAVCR2 antibody, catalog no. 70R-7244
Overview
Overview
| Synonyms | HAVCR2 control peptide, HAVCR2 antibody Blocking Peptide, Anti-HAVCR2 Blocking Peptide, Hepatitis A Virus Cellular Receptor 2 Blocking Peptide, FLJ14428 Blocking Peptide, KIM-3 Blocking Peptide, TIM3 Blocking Peptide, TIMD3 Blocking Peptide, Tim-3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product