HAVCR2 Blocking Peptide (33R-6002)

A synthetic peptide for use as a blocking control in assays to test for specificity of HAVCR2 antibody, catalog no. 70R-7244

Synonyms HAVCR2 control peptide, HAVCR2 antibody Blocking Peptide, Anti-HAVCR2 Blocking Peptide, Hepatitis A Virus Cellular Receptor 2 Blocking Peptide, FLJ14428 Blocking Peptide, KIM-3 Blocking Peptide, TIM3 Blocking Peptide, TIMD3 Blocking Peptide, Tim-3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors