HAX1 antibody (70R-2546)

Rabbit polyclonal HAX1 antibody raised against the middle region of HAX1

Synonyms Polyclonal HAX1 antibody, Anti-HAX1 antibody, HAX 1, Hcls1 Associated Protein X-1 antibody, HCLSBP1 antibody, HAX-1, HAX1, HAX 1 antibody, HAX-1 antibody, SCN3 antibody, HS1BP1 antibody
Specificity HAX1 antibody was raised against the middle region of HAX1
Cross Reactivity Human,Mouse
Applications WB
Immunogen HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP
Assay Information HAX1 Blocking Peptide, catalog no. 33R-5266, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody


Western Blot analysis using HAX1 antibody (70R-2546)

HAX1 antibody (70R-2546) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HAX1 antibody (70R-2546) | HAX1 antibody (70R-2546) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors