HB antibody (70R-3198)

Rabbit polyclonal HB antibody raised against the N terminal Of Hb

Synonyms Polyclonal HB antibody, Anti-HB antibody, Dmel_CG9786 antibody, Rg-pbx antibody, CG9786 antibody, Hb antibody, hbHLH antibody, Rg-bx antibody
Specificity HB antibody was raised against the N terminal Of Hb
Cross Reactivity Drosophila
Applications WB
Immunogen HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
Assay Information HB Blocking Peptide, catalog no. 33R-6336, is also available for use as a blocking control in assays to test for specificity of this HB antibody

Images

Western blot analysis using HB antibody (70R-3198)

Recommended hb Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hb is a gap class segmentation protein that controls development of head structures.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using HB antibody (70R-3198) | Recommended hb Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors