HB Blocking Peptide (33R-6336)
A synthetic peptide for use as a blocking control in assays to test for specificity of hb antibody, catalog no. 70R-3198
Overview
Overview
| Synonyms | HB control peptide, HB antibody Blocking Peptide, Anti-HB Blocking Peptide, Dmel_CG9786 Blocking Peptide, CG9786 Blocking Peptide, Hb Blocking Peptide, Rg-bx Blocking Peptide, Rg-pbx Blocking Peptide, hbHLH Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP |
|---|---|
| Molecular Weight | 83 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Hb is a gap class segmentation protein that controls development of head structures. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product