HBXIP Blocking Peptide (33R-2632)

A synthetic peptide for use as a blocking control in assays to test for specificity of HBXIP antibody, catalog no. 70R-2217

Synonyms HBXIP control peptide, HBXIP antibody Blocking Peptide, Anti-HBXIP Blocking Peptide, Hepatitis B Virus X Interacting Protein Blocking Peptide, MGC71071 Blocking Peptide, XIP Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR
Molecular Weight 18 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors