HBXIP Blocking Peptide (33R-2632)
A synthetic peptide for use as a blocking control in assays to test for specificity of HBXIP antibody, catalog no. 70R-2217
Overview
Overview
| Synonyms | HBXIP control peptide, HBXIP antibody Blocking Peptide, Anti-HBXIP Blocking Peptide, Hepatitis B Virus X Interacting Protein Blocking Peptide, MGC71071 Blocking Peptide, XIP Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR |
|---|---|
| Molecular Weight | 18 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product