HCG_1745121 antibody (70R-3903)

Rabbit polyclonal HCG_1745121 antibody raised against the N terminal Of Hcg_1745121

Synonyms Polyclonal HCG_1745121 antibody, Anti-HCG_1745121 antibody, LOC729920 antibody
Specificity HCG_1745121 antibody was raised against the N terminal Of Hcg_1745121
Cross Reactivity Human
Applications WB
Immunogen HCG_1745121 antibody was raised using the N terminal Of Hcg_1745121 corresponding to a region with amino acids MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP
Assay Information HCG_1745121 Blocking Peptide, catalog no. 33R-6558, is also available for use as a blocking control in assays to test for specificity of this HCG_1745121 antibody


Western Blot analysis using HCG_1745121 antibody (70R-3903)

HCG_1745121 antibody (70R-3903) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HCG_1745121 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of hCG_1745121 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HCG_1745121 antibody (70R-3903) | HCG_1745121 antibody (70R-3903) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors