HDAC9 Blocking Peptide (33R-7773)
A synthetic peptide for use as a blocking control in assays to test for specificity of HDAC9 antibody, catalog no. 70R-1632
Overview
Overview
| Synonyms | HDAC9 control peptide, HDAC9 antibody Blocking Peptide, Anti-HDAC9 Blocking Peptide, Histone Deacetylase 9 Blocking Peptide, DKFZp779K1053 Blocking Peptide, HD7 Blocking Peptide, HDAC Blocking Peptide, HDAC7 Blocking Peptide, HDAC7B Blocking Peptide, HDAC9B Blocking Peptide, HDAC9FL Blocking Peptide, HDRP Blocking Peptide, KIAA0744 Blocking Peptide, MITR Blocking Peptide, HDAC9, HDAC-9, HDAC 9, HDAC-9 Blocking Peptide, HDAC 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII |
|---|---|
| Molecular Weight | 65 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product