HDAC9 Blocking Peptide (33R-7773)

A synthetic peptide for use as a blocking control in assays to test for specificity of HDAC9 antibody, catalog no. 70R-1632

Synonyms HDAC9 control peptide, HDAC9 antibody Blocking Peptide, Anti-HDAC9 Blocking Peptide, Histone Deacetylase 9 Blocking Peptide, DKFZp779K1053 Blocking Peptide, HD7 Blocking Peptide, HDAC Blocking Peptide, HDAC7 Blocking Peptide, HDAC7B Blocking Peptide, HDAC9B Blocking Peptide, HDAC9FL Blocking Peptide, HDRP Blocking Peptide, KIAA0744 Blocking Peptide, MITR Blocking Peptide, HDAC9, HDAC-9, HDAC 9, HDAC-9 Blocking Peptide, HDAC 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
Molecular Weight 65 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors