HDDC3 Blocking Peptide (33R-9007)

A synthetic peptide for use as a blocking control in assays to test for specificity of HDDC3 antibody, catalog no. 70R-4274

Synonyms HDDC3 control peptide, HDDC3 antibody Blocking Peptide, Anti-HDDC3 Blocking Peptide, Hd Domain Containing 3 Blocking Peptide, MGC45386 Blocking Peptide, HDDC3, HDDC-3, HDDC 3, HDDC-3 Blocking Peptide, HDDC 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors