HELLS Blocking Peptide (33R-7725)
A synthetic peptide for use as a blocking control in assays to test for specificity of HELLS antibody, catalog no. 70R-4647
Overview
Overview
| Synonyms | HELLS control peptide, HELLS antibody Blocking Peptide, Anti-HELLS Blocking Peptide, Helicase Lymphoid-Specific Blocking Peptide, FLJ10339 Blocking Peptide, LSH Blocking Peptide, Nbla10143 Blocking Peptide, PASG Blocking Peptide, SMARCA6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD |
|---|---|
| Molecular Weight | 92 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product