HELLS Blocking Peptide (33R-7725)

A synthetic peptide for use as a blocking control in assays to test for specificity of HELLS antibody, catalog no. 70R-4647

Synonyms HELLS control peptide, HELLS antibody Blocking Peptide, Anti-HELLS Blocking Peptide, Helicase Lymphoid-Specific Blocking Peptide, FLJ10339 Blocking Peptide, LSH Blocking Peptide, Nbla10143 Blocking Peptide, PASG Blocking Peptide, SMARCA6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD
Molecular Weight 92 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors