HEXDC antibody (70R-3192)

Rabbit polyclonal HEXDC antibody

Synonyms Polyclonal HEXDC antibody, Anti-HEXDC antibody, Hexosaminidase antibody, FLJ23825 antibody, Glycosyl Hydrolase Family 20 Catalytic Domain Containing antibody
Cross Reactivity Human
Applications WB
Immunogen HEXDC antibody was raised using a synthetic peptide corresponding to a region with amino acids CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA
Assay Information HEXDC Blocking Peptide, catalog no. 33R-1784, is also available for use as a blocking control in assays to test for specificity of this HEXDC antibody


Western Blot analysis using HEXDC antibody (70R-3192)

HEXDC antibody (70R-3192) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEXDC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HEXDC has hexosaminidase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HEXDC antibody (70R-3192) | HEXDC antibody (70R-3192) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors