Hexokinase 2 antibody (70R-3448)

Rabbit polyclonal Hexokinase 2 antibody raised against the middle region of HK2

Synonyms Polyclonal Hexokinase 2 antibody, Anti-Hexokinase 2 antibody, HKII antibody, DKFZp686M1669 antibody, Hexokinase Type -2 antibody, HXK2 antibody, Hexokinase Type 2 antibody, Hexokinase Type 2 antibody, Hexokinase Type -2, Hexokinase Type 2, HK2 antibody, Hexokinase Type 2
Specificity Hexokinase 2 antibody was raised against the middle region of HK2
Cross Reactivity Human
Applications WB
Immunogen Hexokinase 2 antibody was raised using the middle region of HK2 corresponding to a region with amino acids QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR
Assay Information Hexokinase 2 Blocking Peptide, catalog no. 33R-7711, is also available for use as a blocking control in assays to test for specificity of this Hexokinase 2 antibody

Images

Western Blot analysis using Hexokinase 2 antibody (70R-3448)

Hexokinase 2 antibody (70R-3448) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Hexokinase 2 antibody (70R-3448) | Hexokinase 2 antibody (70R-3448) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors