HEY1 antibody (70R-5242)

Rabbit polyclonal HEY1 antibody raised against the N terminal of HEY1

Synonyms Polyclonal HEY1 antibody, Anti-HEY1 antibody, Hairy/Enhancer-Of-Split Related With Yrpw Motif 1 antibody, CHF2 antibody, HERP2 antibody, HESR1 antibody, HRT-1 antibody, MGC1274 antibody, OAF1 antibody
Specificity HEY1 antibody was raised against the N terminal of HEY1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG
Assay Information HEY1 Blocking Peptide, catalog no. 33R-1335, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody


Western blot analysis using HEY1 antibody (70R-5242)

Recommended HEY1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEY1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using HEY1 antibody (70R-5242) | Recommended HEY1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors