HFE Blocking Peptide (33R-6012)
A synthetic peptide for use as a blocking control in assays to test for specificity of HFE antibody, catalog no. 70R-5983
Overview
Overview
| Synonyms | HFE control peptide, HFE antibody Blocking Peptide, Anti-HFE Blocking Peptide, Hemochromatosis Blocking Peptide, HFE1 Blocking Peptide, HH Blocking Peptide, HLA-H Blocking Peptide, MGC103790 Blocking Peptide, dJ221C16.10.1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW |
|---|---|
| Molecular Weight | 40 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product