HFE Blocking Peptide (33R-6012)

A synthetic peptide for use as a blocking control in assays to test for specificity of HFE antibody, catalog no. 70R-5983

Synonyms HFE control peptide, HFE antibody Blocking Peptide, Anti-HFE Blocking Peptide, Hemochromatosis Blocking Peptide, HFE1 Blocking Peptide, HH Blocking Peptide, HLA-H Blocking Peptide, MGC103790 Blocking Peptide, dJ221C16.10.1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW
Molecular Weight 40 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors