HFE2 Blocking Peptide (33R-8826)

A synthetic peptide for use as a blocking control in assays to test for specificity of HFE2 antibody, catalog no. 70R-1988

Synonyms HFE2 control peptide, HFE2 antibody Blocking Peptide, Anti-HFE2 Blocking Peptide, Hemochromatosis Type 2 Blocking Peptide, HFE2A Blocking Peptide, HJV Blocking Peptide, JH Blocking Peptide, MGC23953 Blocking Peptide, RGMC Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors