HIBADH antibody (70R-2529)

Rabbit polyclonal HIBADH antibody raised against the middle region of HIBADH

Synonyms Polyclonal HIBADH antibody, Anti-HIBADH antibody, MGC40361 antibody, 3-Hydroxyisobutyrate Dehydrogenase antibody, NS5ATP1 antibody
Specificity HIBADH antibody was raised against the middle region of HIBADH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Assay Information HIBADH Blocking Peptide, catalog no. 33R-10017, is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody

Images

Western Blot analysis using HIBADH antibody (70R-2529)

HIBADH antibody (70R-2529) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIBADH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HIBADH antibody (70R-2529) | HIBADH antibody (70R-2529) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors