HIPK4 Blocking Peptide (33R-1123)
A synthetic peptide for use as a blocking control in assays to test for specificity of HIPK4 antibody, catalog no. 70R-3234
Overview
Overview
| Synonyms | HIPK4 control peptide, HIPK4 antibody Blocking Peptide, Anti-HIPK4 Blocking Peptide, Homeodomain Interacting Protein Kinase 4 Blocking Peptide, FLJ32818 Blocking Peptide, HIPK4, HIPK-4, HIPK 4, HIPK-4 Blocking Peptide, HIPK 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET |
|---|---|
| Molecular Weight | 69 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product