HIPK4 Blocking Peptide (33R-1123)

A synthetic peptide for use as a blocking control in assays to test for specificity of HIPK4 antibody, catalog no. 70R-3234

Synonyms HIPK4 control peptide, HIPK4 antibody Blocking Peptide, Anti-HIPK4 Blocking Peptide, Homeodomain Interacting Protein Kinase 4 Blocking Peptide, FLJ32818 Blocking Peptide, HIPK4, HIPK-4, HIPK 4, HIPK-4 Blocking Peptide, HIPK 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET
Molecular Weight 69 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors