HIRIP3 antibody (70R-2185)

Rabbit polyclonal HIRIP3 antibody raised against the middle region of HIRIP3

Synonyms Polyclonal HIRIP3 antibody, Anti-HIRIP3 antibody, Hira Interacting Protein 3 antibody
Specificity HIRIP3 antibody was raised against the middle region of HIRIP3
Cross Reactivity Human
Applications WB
Immunogen HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK
Assay Information HIRIP3 Blocking Peptide, catalog no. 33R-8235, is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody

Images

Western Blot analysis using HIRIP3 antibody (70R-2185)

HIRIP3 antibody (70R-2185) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIRIP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HIRIP3 antibody (70R-2185) | HIRIP3 antibody (70R-2185) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors