HIRIP3 antibody (70R-2185)

Rabbit polyclonal HIRIP3 antibody raised against the middle region of HIRIP3

Synonyms Polyclonal HIRIP3 antibody, Anti-HIRIP3 antibody, Hira Interacting Protein 3 antibody
Specificity HIRIP3 antibody was raised against the middle region of HIRIP3
Cross Reactivity Human
Applications WB
Immunogen HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK
Assay Information HIRIP3 Blocking Peptide, catalog no. 33R-8235, is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody


Western Blot analysis using HIRIP3 antibody (70R-2185)

HIRIP3 antibody (70R-2185) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIRIP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HIRIP3 antibody (70R-2185) | HIRIP3 antibody (70R-2185) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors