HISPPD1 antibody (70R-2403)

Rabbit polyclonal HISPPD1 antibody raised against the middle region of HISPPD1

Synonyms Polyclonal HISPPD1 antibody, Anti-HISPPD1 antibody, PPIP5K2 antibody, FLJ21506 antibody, Histidine Acid Phosphatase Domain Containing 1 antibody, KIAA0433 antibody, VIP2 antibody
Specificity HISPPD1 antibody was raised against the middle region of HISPPD1
Cross Reactivity Human,Mouse
Applications WB
Immunogen HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV
Assay Information HISPPD1 Blocking Peptide, catalog no. 33R-8626, is also available for use as a blocking control in assays to test for specificity of this HISPPD1 antibody


Western Blot analysis using HISPPD1 antibody (70R-2403)

HISPPD1 antibody (70R-2403) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 138 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HISPPD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC and PP-IP5 (also called IP7) kinase (EC activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HISPPD1 antibody (70R-2403) | HISPPD1 antibody (70R-2403) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors