HIST2H2BF antibody (70R-2096)

Rabbit polyclonal HIST2H2BF antibody raised against the N terminal of HIST2H2BF

Synonyms Polyclonal HIST2H2BF antibody, Anti-HIST2H2BF antibody, HIST2, HIST 2 antibody, HIST-2 antibody, HIST 2, HIST-2, Histone Cluster 2 H2Bf antibody, MGC131639 antibody
Specificity HIST2H2BF antibody was raised against the N terminal of HIST2H2BF
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HIST2H2BF antibody was raised using the N terminal of HIST2H2BF corresponding to a region with amino acids MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
Assay Information HIST2H2BF Blocking Peptide, catalog no. 33R-6272, is also available for use as a blocking control in assays to test for specificity of this HIST2H2BF antibody


Western Blot analysis using HIST2H2BF antibody (70R-2096)

HIST2H2BF antibody (70R-2096) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIST2H2BF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HIST2H2BF antibody (70R-2096) | HIST2H2BF antibody (70R-2096) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors