HMBS antibody (70R-3343)

Rabbit polyclonal HMBS antibody raised against the N terminal of HMBS

Synonyms Polyclonal HMBS antibody, Anti-HMBS antibody, UPS antibody, PBGD antibody, Hydroxymethylbilane Synthase antibody, PBG-D antibody
Specificity HMBS antibody was raised against the N terminal of HMBS
Cross Reactivity Human
Applications WB
Immunogen HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA
Assay Information HMBS Blocking Peptide, catalog no. 33R-6388, is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Images

Western Blot analysis using HMBS antibody (70R-3343)

HMBS antibody (70R-3343) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HMBS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HMBS antibody (70R-3343) | HMBS antibody (70R-3343) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors