HMGCS2 antibody (70R-1139)

Rabbit polyclonal HMGCS2 antibody

Synonyms Polyclonal HMGCS2 antibody, Anti-HMGCS2 antibody, 3-Hydroxy-3-Methylglutaryl-Coenzyme A Synthase 2 antibody
Cross Reactivity Human
Applications WB
Immunogen HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE
Assay Information HMGCS2 Blocking Peptide, catalog no. 33R-2060, is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody


Western Blot analysis using HMGCS2 antibody (70R-1139)

HMGCS2 antibody (70R-1139) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HMGCS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HMGCS2 antibody (70R-1139) | HMGCS2 antibody (70R-1139) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors