HNF4G antibody (70R-1918)

Rabbit polyclonal HNF4G antibody raised against the C terminal of HNF4G

Synonyms Polyclonal HNF4G antibody, Anti-HNF4G antibody, NR2A2 antibody, Hepatocyte Nuclear Factor 4 Gamma antibody, HNF-4 antibody, HNF 4, HNF 4 antibody, HNF-4, HNF4
Specificity HNF4G antibody was raised against the C terminal of HNF4G
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HNF4G antibody was raised using the C terminal of HNF4G corresponding to a region with amino acids QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS
Assay Information HNF4G Blocking Peptide, catalog no. 33R-7508, is also available for use as a blocking control in assays to test for specificity of this HNF4G antibody


Western blot analysis using HNF4G antibody (70R-1918)

Recommended HNF4G Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNF4G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using HNF4G antibody (70R-1918) | Recommended HNF4G Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using HNF4G antibody (70R-1918) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors