HNF4G Blocking Peptide (33R-7508)
A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4G antibody, catalog no. 70R-1918
Overview
Overview
| Synonyms | HNF4G control peptide, HNF4G antibody Blocking Peptide, Anti-HNF4G Blocking Peptide, Hepatocyte Nuclear Factor 4 Gamma Blocking Peptide, NR2A2 Blocking Peptide, HNF4, HNF-4, HNF 4, HNF-4 Blocking Peptide, HNF 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS |
|---|---|
| Molecular Weight | 50 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product