HNRPDL antibody (70R-1322)

Rabbit polyclonal HNRPDL antibody raised against the middle region of HNRPDL

Synonyms Polyclonal HNRPDL antibody, Anti-HNRPDL antibody, Heterogeneous Nuclear Ribonucleoprotein D-Like antibody
Specificity HNRPDL antibody was raised against the middle region of HNRPDL
Cross Reactivity Human, Mouse, Dog
Applications IHC, WB
Immunogen HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL
Assay Information HNRPDL Blocking Peptide, catalog no. 33R-9199, is also available for use as a blocking control in assays to test for specificity of this HNRPDL antibody


Immunohistochemical staining using HNRPDL antibody (70R-1322)

HNRPDL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPDL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HNRPDL antibody (70R-1322) | HNRPDL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.
  • Western Blot analysis using HNRPDL antibody (70R-1322) | HNRPDL antibody (70R-1322) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using HNRPDL antibody (70R-1322) | HNRPDL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors